Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RDR-PLA2G10-Hu-48Tests 48 Tests
EUR 652.8

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RDR-PLA2G10-Hu-96Tests 96 Tests
EUR 907.2

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
EH3603 96T
EUR 628.92
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Phospholipase A2, Group X (PLA2G10)ELISA kit
201-12-2526 96 tests
EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
20-abx152758
  • EUR 8853.60
  • EUR 4719.60
  • EUR 1093.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx252990-96tests 96 tests
EUR 801.6

Human Phospholipase A2, Group X(PLA2G10)ELISA Kit
QY-E05176 96T
EUR 433.2

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-10x96wellstestplate 10x96-wells test plate
EUR 5677.8
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x48wellstestplate 1x48-wells test plate
EUR 572.76
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x96wellstestplate 1x96-wells test plate
EUR 766.8
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-5x96wellstestplate 5x96-wells test plate
EUR 3090.6
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
4-SED833Hu
  • EUR 5738.40
  • EUR 3031.20
  • EUR 768.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Phospholipase A2, Group X (PLA2G10)ELISA kit
YLA3195HU-48T 48T
EUR 435

Human Phospholipase A2, Group X (PLA2G10)ELISA kit
YLA3195HU-96T 96T
EUR 562.5

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx174048
  • EUR 1028.40
  • EUR 526.80
  • 1 mg
  • 200 ug

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx126373
  • EUR 493.20
  • EUR 710.40
  • EUR 218.40
  • EUR 376.80
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx128169
  • EUR 510.00
  • EUR 159.60
  • EUR 1446.00
  • EUR 693.60
  • EUR 393.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx301835
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Recombinant Phospholipase A2, Group X (PLA2G10)
4-RPD833Hu01
  • EUR 601.69
  • EUR 284.40
  • EUR 1926.34
  • EUR 722.11
  • EUR 1324.22
  • EUR 477.60
  • EUR 4635.84
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli

Human Phospholipase A2, Group X (PLA2G10) Protein
20-abx167064
  • EUR 844.80
  • EUR 343.20
  • EUR 2598.00
  • EUR 994.80
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx356098-96tests 96 tests
EUR 990

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362012-96tests 96 tests
EUR 990

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362347-96tests 96 tests
EUR 990

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx360270-96tests 96 tests
EUR 990

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
abx197460-96tests 96 tests
EUR 990

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
20-abx494408
  • EUR 9567.60
  • EUR 5095.20
  • EUR 1177.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-EL-H1011 1 plate of 96 wells
EUR 640.8
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
ELK4236 1 plate of 96 wells
EUR 518.4
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Phospholipase A2, Group X (PLA2G10) Antibody (HRP)
20-abx315919
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)
20-abx315920
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)
20-abx315921
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)
4-PAD833Hu01
  • EUR 296.40
  • EUR 3012.00
  • EUR 750.00
  • EUR 372.00
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)

CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-CL-H0681 1 plate of 96 wells
EUR 700.8
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC
4-PAD833Hu01-APC
  • EUR 414.00
  • EUR 3930.00
  • EUR 1094.40
  • EUR 528.00
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated
4-PAD833Hu01-Biotin
  • EUR 373.20
  • EUR 2952.00
  • EUR 872.40
  • EUR 457.20
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3
4-PAD833Hu01-Cy3
  • EUR 502.80
  • EUR 5190.00
  • EUR 1410.00
  • EUR 654.00
  • EUR 301.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC
4-PAD833Hu01-FITC
  • EUR 355.20
  • EUR 3168.00
  • EUR 900.00
  • EUR 446.40
  • EUR 234.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP
4-PAD833Hu01-HRP
  • EUR 379.20
  • EUR 3426.00
  • EUR 968.40
  • EUR 477.60
  • EUR 247.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE
4-PAD833Hu01-PE
  • EUR 355.20
  • EUR 3168.00
  • EUR 900.00
  • EUR 446.40
  • EUR 234.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7
4-PAD833Hu01-APC-Cy7
  • EUR 685.20
  • EUR 7716.00
  • EUR 2046.00
  • EUR 912.00
  • EUR 382.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085HU-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085HU
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT
ELI-37033h 96 Tests
EUR 988.8

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085MO-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085MO
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085RA-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085RA
  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT
ELI-16162m 96 Tests
EUR 1038

PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
PROTO15496 Regular: 10ug
EUR 380.4
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Share

You May Have Missed

Goat

Compare Assays lab reagents for research

2 min read
Goat

Compare rec. lab reagents for research

2 min read
Goat

Appoptosis Lab Reagents for Research

2 min read
The Role of the Anthropologist in the Application of NamUs.
Blocking blocking peptide Bovine Canine Chemical Chicken Donkey extract Feline Goat Guinea Hamster Horse Human Mink Mollusc Monkey Mouse Pig Plant Porcine Rabbit Turkey Vertebrate Virus Whale Xenopus Yeast Zebrafish

The Role of the Anthropologist in the Application of NamUs.

16 min read